Перейти в содержание Вестника РНЦРР МЗ РФ N1.

 

Использование интернализуемых пептидов для доставки физиологически активных фрагментов р16INK4a внутрь клетки.

 

Харченко В.П.*, Боженко В.К.*, Олферьев М.А*, Лунин В.Г.#, Шмаров М.М.#, Логунов М.Ю.#,  Кулинич Т.М.* Бубнов В.В.^

 

*Российский научный центр рентгенорадиологии МЗ РФ г. Москва.

#Институт сельскохозяйственной биотехнологии РАСХН г. Москва.

^Одесский Государственный медицинский университет МЗУ г. Одесса.

 

Адрес документа для ссылки: http://vestnik.rncrr.ru/vestnik/v1/papers/bazh.htm

 

Технология проникающих пептидов позволяет доставлять в клетку физиологически активные макромолекулы - фрагменты белков и олигонуклеотиды. Получение таких молекул важно как в исследовательских, так и терапевтических целях. Нами была исследована группа проникающих пептидов на основе pANTP и фрагмента белка p16INK4a (pANTP-p16INK4a). В экспериментах на клеточных линиях данные пептиды эффективно проникали через клеточную мембрану и накапливались в клетках. В экспериментах на клеточных линиях они тормозили клеточное деление и увеличивали клеточную гибель.

 

The technology of penetrating peptides allows deliver the physiologically active macromolecules, such as peptides and oliginucletides, into cell. Study of these molecules may be important as in research and the medical purposes. We investigated group penetrating peptides on a basis of pANTP peptide and a fragment of p16INK4a protein (pANTP-p16INK4a). In experiences on cellular lines these peptides penetrated cell membrane and collected into cells. Also they braked cellular division and increased cell death in experiments with cell lines.

 

Ключевые слова: проникающие пептиды, pANTP, p16INK4a, апоптоз, клеточная пролиферация, клеточный цикл, мембраны, клеточная мембрана.

 

Keywords: penetrating peptides, pANTP, p16INK4a, apoptosis, cell proliferation, cell cycle, membrane, cell membrane.

 

До последнего времени использование в исследовательских и терапевтических целях полипептидов и олигонуклеотидов было ограничено из-за их низкой проницаемости через биомембраны и их относительно быстрой деградации внутри клетки. Это ограничение было препятствием, как для биомедицинских исследований, так и для фармацевтической индустрии. Транспорт гидрофильных макромолекул в цитоплазматическое пространство и в ядро живой клетки без разрушения мембран казался невозможным. В тоже время, доставка биологически активных макромолекул внутрь клетки открывает широкие перспективы для манипулирования биологическими объектами. Поэтому, открытие пептидов, способных проникать в клетку без участия мембранных белков и способных осуществлять внутриклеточный транспорт связанных с ними белковых фрагментов и олигонуклеотидов открывает новый этап в развитии биологии и медицины. В русскоязычной литературе пока нет общепринятого термина для обозначения данных пептидов. В иностранной литературе они получили название «cell penetrating peptide» - проникающие пептиды (1, 5, 8).

Пептиды, способные проникать в клетку, выделены из белков различных организмов от вирусов (ВИЧ-1, герпеса, гриппа) до позвоночных (кайман). В этих организмах они выполняют разнообразные функции. Так пептид pANTP получен из белка регулирующего процессы развития плодовой мухи Дрозофилы (1). Фрагментом капсидного белка вируса иммунодифицита ВИЧ-1 является проникающий пептид TAT (5, 8), а вируса простого герпеса - пептид VP22 (3).

По физико-химическим свойствам проникающие пептиды можно разделить на две группы – гидрофобные (FGF гликопротеина саркомы Капоши, gp41 гликопротеина ВИЧ-1 и Ig(v) легкой цепи иммуноглобулина каймана) и амфифильные (Hel 11-7 гемаглютинина вируса гриппа, TAT, VP22 и pANTP). Длина таких пептидов колеблется от 11 до 30 аминокислот. Анализ аминокислотных последовательностей проникающих пептидов не выявил их гомологии, однако было замечено, что в них почти всегда присутствует несколько молекул аргинина. Обнаружение такой закономерности позволило ряду исследователей рассматривать интернализацию как свойство пептидов богатых аргинином. Однако позднее были синтезированы аминокислотные последовательности, не содержащие аргинина, но обладающие способностью проникать через цитоплазматические мембраны (6).

Механизм транспорта проникающих пептидов через клеточную мембрану в настоящее время не понятен. Однако известно, что он происходит без участия мембранных белков, практически не зависит от характера экспрессии углеводов и энергетически независим (2). Некоторые проникающие пептиды (ТАТ, VP22) способны проникать через внутриклеточные мембраны и накапливаться в ядре клетки. Экспериментально доказано, что проникающие пептиды  с одинаковой эффективностью пенетрируют в клетки разных типов, и даже способны преодолевать гистогематические барьеры у млекопитающих (9).

Оказалось, что данные пептиды могут переносить через мембрану клетки связанные с ними ковалентно аминокислотные и олигонуклеотидные последовательности с молекулярной массой до нескольких килодальтон, и которые длительное время не подвергаются внутриклеточному гидролизу, т.к. находятся вне зоны действия лизосомальных ферментов. Таким образом, проникающие пептиды  могут выступать в роли механизма транспорта физиологически активных участков макромолекул в цитоплазму и даже в ядро клетки (11). Такие уникальные свойства проникающих пептидов позволили целенаправленно создавать “химерные” молекулы, состоящие из проникающего пептида и ковалентно с ним связанного фрагмента макромолекулы (9, 11). Одним из эффективных переносчиков крупных молекул внутрь клеток является проникающий пептид pANTP, свойства которого достаточно изучены (1, 9).

Целью данной работы являлось изучение транспорта и физиологической активности фрагмента белка p16INK4a, в виде химерной молекулы с проникающим пептидом pANTP. Этот белок является регулятором клеточного деления, а повреждения его гена часто встречаются в геноме клеток опухолевой ткани. Введение активного фрагмента этого белка в опухолевые клетки тормозило их рост и приводило к активации механизма апоптоза (7, 10). Создание физиологически активного химерного белка, способного легко проникать через клеточные мембраны и регулировать деление клеток, открывает новые перспективы в терапии, особенно онкологических заболеваний.

 

Материалы и методы.

 

В исследовании использовались как пептиды полученные путём химического синтеза (A, Б, В) так и с использованием генно-инженерных технологий (Г, Д). Аминокислотная последовательность пептида (А) содержала фрагмент pANTP на N-конце и -p16INK4a на С-конце. Напротив пептид (Б) содержал фрагмент пептида p16INK4a на N-конце, а pANTP на С-конце. Контрольный пептид (В) состоял только из пептида pANTP. Пептиды (Г и Д) полученные генно-инженерными методами имели более длинную аминокислотной последовательностью пептида pANTP, что было связано с методами их получения. Отличия в структуре данных пептидов представлены в таблице 1.

 

 

Таблица 1 Аминокислотная последовательность исследуемых пептидов

 

А

pANTP-p16INK4a

NH2-RQIKIWFQNRRMKWDAAREGFLDTLVVLHRAGAR-COOH

 

Б

pANTP-p16INK4a

NH2-DAAREGFLDTLVVLHRAGARSRQIKIWFQNRRMKWKK-COOH

 

В

pANTP

NH2-RQIKIWFQNRRMKWKK-COOH

Г

pANTP-p16INK4a

NH2-RGSDAAREGFLDTLVVLHRAGARSERKRGRQTYTRYQTL

ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK

ENKTKGEPRS-COOH

 

Д

pANTP

NH2-RSERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIA

HALCLTERQIKIWFQNRRMKWKKENKTKGEPRS-COOH

Аминокислотная последовательность представлена в однобуквенном коде.

Курсив - активный фрагмент p16INK4a

Подчеркнут – проникающий пептид pANTP

 

В работе использовались линии культуры клеток человека: Raji, Jurkatt, A549, и клеточная культура 293 из эмбриональной почки хомяка. Культуры клеточных линий выращивались на среде DMEM (ПанЭко №С410) или RPMI-1640 (ПанЭко №С310) содержащую 10%-ную эмбриональную телячью сыворотку (BioWestS1800) стандартными методами.

Оценка проницаемости пептидов в клетки изучалась с помощью флуоресцентного микроскопа (Leika, TCS Confocal/Multiphoton system). Для чего культуры клеточных линий 293 и A549 выращивались в среде DMEM содержащей 10%-ную эмбриональную телячью сыворотку на стерильных покровных стёклах для конфокальной микроскопии. Стекла осторожно ополаскивали фосфатно-солевым буферным раствором (ФСБ) и переносили в камеру для исследований. В эту же камеру добавляли ФСБ, содержащий изучаемые пептиды, частично меченные флуоресцентным красителем - флуоресцеин-изотиоционатом (ФИТЦ), и наблюдали за процессом изменения флуоресценции внутри клетки (проникновения пептида) в течение получаса.

Скорость проникновения пептидов в клетки оценивали на проточном цитофлуорометре DAKOGalaxy”. Изучаемые пептиды связанные с ФИТЦ добавляли к суспензии клеток Raji, Jurkatt или периферической крови человека непосредственно в процессе измерения и исследовали изменение интенсивности флуоресценции клеток.

Внутриклеточную физиологическую активность пептидов исследовали по уровню апоптоза и скорости роста клеточных линий с использованием метода флуоресцентной проточной цитометрии. После инкубации с пептидами клетки окрашивались пропидиeм йодидом (Sigma, № p4170) и исследовались на проточном цитофлуорометре DAKOGalaxy”. Полученные ДНК гистограммы анализировались с использованием программы ModFit LT 3.0 (Verity Software House). Исследования проводились на всех клеточных линиях. Уровень апоптоза оценивался как субдиплойдный пик на ДНК гистограммах. Скорость пролиферации по доле клеток находящих в S и G2M фазах клеточного цикла (4).

 

Результаты и обсуждения

 

Получение изучаемых проникающих пептидов возможно с использованием двух подходов: методами химического синтеза и методами генной инженерии. Метод химического синтеза позволяет получать различные пептиды достаточно быстро, но в малых количествах. Методами генной инженерии можно получать изучаемые белковые фрагменты в значительных количествах, но при этом этот они содержат в своей структурной последовательности большее количество аминокислот. Поэтому был использован фрагмент белка pANTP состоящий из 69 аминокислот. Генно-инженерный продукт также содержал две дополнительные аминокислоты (R и S). Влияние этих аминокислот на проницаемость было проверено с использованием короткого пептида синтезированного химически (Таблица 1).

В проведенных экспериментах было установлено, что все исследуемые пептиды эффективно проникают внутрь клетки. При этом проникновение универсально для всех исследуемых клеточных линий и клеток периферической крови. Уже через 1 минуту после добавления пептида наблюдалось окрашивание цитоплазмы клетки вблизи внешней клеточной мембраны. Через 15 минут пептид распределялись уже по всей клетки. В дальнейшем характер окрашивания не менялся, и не наблюдалось преимущественного накопления пептида в определённых внутриклеточных структурах. На рисунке 1 показана типичная картина накопления ФИТЦ-меченного химерного пептида pANTP-p16INK4a в клетке. Наблюдение за распределением проводилось в одном оптическом слое на уровне ядра клетки.

 

Рисунок 1.

Инкубация суспензии клеток линии Raji, Jurkatt, а так же клеток периферической крови человека в течение 5 минут с ФИТЦ-меченными химерными пептидами pANTP-p16INK4a приводила к увеличению интенсивности флуоресценции клеток уже при концентрации пептида 0.1 мкМ (конечная концентрация) и резко увеличивалась при концентрации 10 мкМ. Таким образом, изученные химерные пептиды обладали высокой проницаемостью в клетки, сравнимой с проницаемостью проникающего пептида pANTP (Рис. 2).

 

 

 

 

 

Рисунок 2.

Добавление химерных ФИТЦ-меченных пептидов непосредственно к клеткам в процессе измерения флуоресценции в камере проточного цитофлуорометра позволило оценить скорости их проникновения в клетки. Как видно на рисунке 3 добавление pANTP-p16INK4a приводило к многократному увеличению флуоресценции в течение 5-10 секунд, что подтверждает высокую скорость его проникновения в клетку.

Рисунок  3.  

 

Инкубация изученных культур клеток с химерным пептидом pANTP-p16INK4a в концентрации 5 мкМ приводила к заметному достоверному увеличению уровня апоптоза по сравнению с нативными клетками (контроль) или при их инкубации с 10 мкМ pANTP. При концентрации pANTP-p16INK4a 10 мкМ уровень апоптоза был в 7 раз выше по сравнению с контрольными образцами (Рис. 4).  Приведенные данные свидетельствуют об отсутствии физиологической активности у проникающих пептидов pANTP и выраженной способности химерных пептидов pANTP-p16INK4a усиливать апоптоз (гибель клетки). Так же отмечалось влияние пептидов pANTP-p16INK4a на скорость пролиферации клеток, выражающуюся в снижение уровня S фазы клеточного цикла. В экспериментах на клеточных линиях A549 и 293 при добавлении пептида pANTP-p16INK4a (Б) в концентрации 10 мкМ доля клеток находящихся в S фазе клеточного цикла уменьшалась в 1,6 и 1,4 раза соответственно.

 

Рисунок 4.

 

Таким образом, как химически синтезированные, так и созданные с применением генно-инженерных технологий химерные пептиды на основе проникающего пептида pANTP и фрагмента белка p16INK4a эффективно проникали через цитоплазматические мембраны всех исследованных нами клеточных линий и клеток периферической крови. При этом они оказывали физиологическое воздействие, тормозя клеточное деление и увеличивая клеточную гибель.

 

 

 

 

Список цитируемой литературы:

 

  1. Derossi D., Joliot A., Chassaing G., Prochiantz A. The third helix of the Antennapedia  homeodamain translocates through membranes. J. Biol. Chem., 269, p. 10444-10450, 1994.
  2. Drin G., Temsamani J. Physico-chemical requirements for cellular uptake of pANTP peptide: role of lipid-binding affinity Eur J Biochem., 268, p. 1304-1314, 2001.
  3. Eliot G., O’Hare P. Intercellular trafficking and protein delivery by a herpesvirus structural protein. Cell., 24, p.  223-33, 1997.
  4. Elstein KH., Thomas DJ., Zucker RM. Factors affecting flow cytometric detection of apoptotic nuclei by DNA analysis. Cytometry, 21, p. 170-176, 1995.
  5. Frankel A. D., Pabo C. O. cellular uptake of the tat protein from human immunodeficiency virus Cell, 55, p. 1189-1193, 1988.
  6. Futaki S. Arginine-right peptides: potential for intracellular delivery of macromolecules and the mystery of the translocation mechanisms. International Journal of Pharmaceutics, 245, p. 1-7, 2002.
  7. Gius D., Ezhevsky SA., Becker-Hapak M., Nagahara H., Wei MC., Dowdy SF. Transduced p16INK4a peptides inhibit hypo-phosphorylation of the retinoblastoma protein and cell cycles progression prior to activation of CDK2 complex in late G1. Cancer. Res., 59, p. 2577-2580, 1999.
  8. Green M., Loewenstein PM. Autonomous functional domains of chemically synthesized human immunodeficiency virus tat trans-activator protein. Cell, 55, p. 1179-1188, 1988.
  9. Morris MC., Depollier J., Mery J., Heitz F., Devita G. A peptides carrier for the delivery of biologically active proteins in mammalian cells. Nat. Biotechnology, 19, p. 1173-1176, 2001.
  10. Ruas M., Gordon P.  The p16INK4a/CDKN2A tumor suppressor and its relative. Biochemica et Biophysica Acta, 1378, p. F115-F117, 1998.
  11. Wadia JS., Dowdy SF. Protein transduction technology. Curr. Opin. Biotechnol., 13, p. 52-56, 2002.

 

© Вестник РНЦРР Минздрава России

©  Российсий научный центр рентгенорадиологии Минздрава России